SCOPe 2.08: Domain d3o8xa2: 3o8x A:186-279

Lineage for d3o8xa2 (3o8x A:186-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88616] (12 PDB entries)

8. Domain d3o8xa2: 3o8x A:186-279 [200017]
   Other proteins in same PDB: d3o8xa1, d3o8xb_, d3o8xc1, d3o8xc2, d3o8xd1, d3o8xd2
   automated match to d1onqa1
   complexed with gsl, nag

Details for d3o8xa2

PDB Entry: 3o8x, 2.74 Å

PDB Description: recognition of glycolipid antigen by inkt cell tcr

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3o8xa2:

Sequence, based on SEQRES records:

>d3o8xa2 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d3o8xa2 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpsrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqat
ldveageeaglacrvkhsslggqdiilyw

Timeline for d3o8xa2:

• d3o8xa2 first appeared in SCOPe 2.03
  
• d3o8xa2 appears in SCOPe 2.07