Lineage for d3o8xa2 (3o8x A:186-279)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2349359Protein CD1, alpha-3 domain [88615] (5 species)
  7. 2349391Species Mouse (Mus musculus) [TaxId:10090] [88616] (11 PDB entries)
  8. 2349404Domain d3o8xa2: 3o8x A:186-279 [200017]
    Other proteins in same PDB: d3o8xa1, d3o8xb_, d3o8xc1, d3o8xc2, d3o8xd1, d3o8xd2
    automated match to d1onqa1
    complexed with fuc, gsl, nag

Details for d3o8xa2

PDB Entry: 3o8x (more details), 2.74 Å

PDB Description: recognition of glycolipid antigen by inkt cell tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3o8xa2:

Sequence, based on SEQRES records: (download)

>d3o8xa2 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d3o8xa2 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpsrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqat
ldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3o8xa2:

Click to download the PDB-style file with coordinates for d3o8xa2.
(The format of our PDB-style files is described here.)

Timeline for d3o8xa2: