Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (31 PDB entries) |
Domain d3o8xa1: 3o8x A:7-185 [200016] Other proteins in same PDB: d3o8xa2, d3o8xb_, d3o8xc1, d3o8xc2, d3o8xd1, d3o8xd2 automated match to d1onqa2 complexed with gsl, nag |
PDB Entry: 3o8x (more details), 2.74 Å
SCOPe Domain Sequences for d3o8xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o8xa1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3o8xa1: