Lineage for d3o8xa1 (3o8x A:7-185)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1406890Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1406891Protein automated matches [226842] (3 species)
    not a true protein
  7. 1406914Species Mouse (Mus musculus) [TaxId:10090] [224924] (24 PDB entries)
  8. 1406930Domain d3o8xa1: 3o8x A:7-185 [200016]
    Other proteins in same PDB: d3o8xa2, d3o8xb_, d3o8xc1, d3o8xc2, d3o8xd1, d3o8xd2
    automated match to d1onqa2
    complexed with gsl, nag

Details for d3o8xa1

PDB Entry: 3o8x (more details), 2.74 Å

PDB Description: recognition of glycolipid antigen by inkt cell tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3o8xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o8xa1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3o8xa1:

Click to download the PDB-style file with coordinates for d3o8xa1.
(The format of our PDB-style files is described here.)

Timeline for d3o8xa1: