SCOPe 2.08: Domain d3o8xa1: 3o8x A:7-185

Lineage for d3o8xa1 (3o8x A:7-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d3o8xa1: 3o8x A:7-185 [200016]
   Other proteins in same PDB: d3o8xa2, d3o8xb_, d3o8xc1, d3o8xc2, d3o8xd1, d3o8xd2
   automated match to d1onqa2
   complexed with gsl, nag

Details for d3o8xa1

PDB Entry: 3o8x, 2.74 Å

PDB Description: recognition of glycolipid antigen by inkt cell tcr

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3o8xa1:

Sequence; same for both SEQRES and ATOM records:

>d3o8xa1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d3o8xa1:

• d3o8xa1 first appeared in SCOPe 2.03
  
• d3o8xa1 appears in SCOPe 2.07