SCOPe 2.07: Domain d3o7na_: 3o7n A:

Lineage for d3o7na_ (3o7n A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)

8. Domain d3o7na_: 3o7n A: [200015]
   automated match to d3k3ua_
   complexed with bml, hem, so4; mutant

Details for d3o7na_

PDB Entry: 3o7n, 1.72 Å

PDB Description: The V59W mutation blocks the distal pocket of the hemoglobin - dehaloperoxidase from Amphitrite ornata

PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d3o7na_:

Sequence; same for both SEQRES and ATOM records:

>d3o7na_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekwf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d3o7na_:

• d3o7na_ first appeared in SCOPe 2.03
  
• d3o7na_ appears in SCOPe 2.06
  
• d3o7na_ appears in the current release, SCOPe 2.08