Lineage for d3o4le1 (3o4l E:2-117)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520172Domain d3o4le1: 3o4l E:2-117 [200010]
    Other proteins in same PDB: d3o4la1, d3o4la2, d3o4lb_, d3o4ld2
    automated match to d1beca1
    complexed with gol, mes, so4

Details for d3o4le1

PDB Entry: 3o4l (more details), 2.54 Å

PDB Description: Genetic and structural basis for selection of a ubiquitous T cell receptor deployed in Epstein-Barr virus
PDB Compounds: (E:) T-cell receptor, beta chain

SCOPe Domain Sequences for d3o4le1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o4le1 b.1.1.0 (E:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gavvsqhpswvicksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsnegskatyeq
gvekdkflinhasltlstltvtsahpedssfyicsardgtgngytfgsgtrltvve

SCOPe Domain Coordinates for d3o4le1:

Click to download the PDB-style file with coordinates for d3o4le1.
(The format of our PDB-style files is described here.)

Timeline for d3o4le1: