Lineage for d3o4ld2 (3o4l D:112-201)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763448Domain d3o4ld2: 3o4l D:112-201 [200009]
    Other proteins in same PDB: d3o4la1, d3o4la2, d3o4lb_, d3o4ld1, d3o4le1, d3o4le2
    automated match to d1qrnd2
    complexed with gol, mes, so4

Details for d3o4ld2

PDB Entry: 3o4l (more details), 2.54 Å

PDB Description: genetic and structural basis for selection of a ubiquitous t cell receptor deployed in epstein-barr virus
PDB Compounds: (D:) T-cell receptor, alpha chain

SCOPe Domain Sequences for d3o4ld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o4ld2 b.1.1.2 (D:112-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d3o4ld2:

Click to download the PDB-style file with coordinates for d3o4ld2.
(The format of our PDB-style files is described here.)

Timeline for d3o4ld2: