SCOPe 2.03: Domain d3o4ld2: 3o4l D:112-201

Lineage for d3o4ld2 (3o4l D:112-201)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d3o4ld2: 3o4l D:112-201 [200009]
   Other proteins in same PDB: d3o4la1, d3o4la2, d3o4lb_, d3o4ld1, d3o4le1, d3o4le2
   automated match to d1qrnd2
   complexed with gol, mes, so4

Details for d3o4ld2

PDB Entry: 3o4l, 2.54 Å

PDB Description: genetic and structural basis for selection of a ubiquitous t cell receptor deployed in epstein-barr virus

PDB Compounds: (D:) T-cell receptor, alpha chain

SCOPe Domain Sequences for d3o4ld2:

Sequence; same for both SEQRES and ATOM records:

>d3o4ld2 b.1.1.2 (D:112-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Timeline for d3o4ld2:

• d3o4ld2 is new in SCOPe 2.03-stable
  
• d3o4ld2 appears in SCOPe 2.04
  
• d3o4ld2 appears in the current release, SCOPe 2.08