SCOPe 2.05: Domain d3o4ld1: 3o4l D:7-111

Lineage for d3o4ld1 (3o4l D:7-111)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3o4ld1: 3o4l D:7-111 [200008]
   Other proteins in same PDB: d3o4la1, d3o4la2, d3o4lb_, d3o4ld2
   automated match to d1qrnd1
   complexed with gol, mes, so4

Details for d3o4ld1

PDB Entry: 3o4l, 2.54 Å

PDB Description: genetic and structural basis for selection of a ubiquitous t cell receptor deployed in epstein-barr virus

PDB Compounds: (D:) T-cell receptor, alpha chain

SCOPe Domain Sequences for d3o4ld1:

Sequence; same for both SEQRES and ATOM records:

>d3o4ld1 b.1.1.0 (D:7-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qslflsvregdssvinctytdssstylywykqepgaglqlltyifsnmdmkqdqrktvll
nkkdkhlslriadtqtgdsaiyfcaednnarlmfgdgtqlvvkpn

Timeline for d3o4ld1:

• d3o4ld1 first appeared in SCOPe 2.03
  
• d3o4ld1 appears in SCOPe 2.04
  
• d3o4ld1 appears in SCOPe 2.06
  
• d3o4ld1 appears in the current release, SCOPe 2.08