SCOPe 2.03: Domain d3o3dd1: 3o3d D:1-181

Lineage for d3o3dd1 (3o3d D:1-181)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
   Uniprot P01892 25-298

8. Domain d3o3dd1: 3o3d D:1-181 [200000]
   Other proteins in same PDB: d3o3da2, d3o3db_, d3o3dd2, d3o3de_
   automated match to d1i4fa2
   complexed with gol

Details for d3o3dd1

PDB Entry: 3o3d, 1.7 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the Peptidomimetic ELA-2

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3o3dd1:

Sequence; same for both SEQRES and ATOM records:

>d3o3dd1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d3o3dd1:

• d3o3dd1 is new in SCOPe 2.03-stable
  
• d3o3dd1 appears in SCOPe 2.04
  
• d3o3dd1 appears in the current release, SCOPe 2.08