![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (184 PDB entries) Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor |
![]() | Domain d2gfbi1: 2gfb I:1-108 [20000] Other proteins in same PDB: d2gfba2, d2gfbb1, d2gfbb2, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo2, d2gfbp1, d2gfbp2 part of Fab CNJ206; H-chains in this entry seem to be mistraced in VH region |
PDB Entry: 2gfb (more details), 3 Å
SCOPe Domain Sequences for d2gfbi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbi1 b.1.1.1 (I:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilr
Timeline for d2gfbi1:
![]() Domains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp1, d2gfbp2 |