Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries) |
Domain d2gfbh1: 2gfb H:1-119 [19999] Other proteins in same PDB: d2gfba2, d2gfbb2, d2gfbc2, d2gfbd2, d2gfbe2, d2gfbf2, d2gfbg2, d2gfbh2, d2gfbi2, d2gfbj2, d2gfbk2, d2gfbl2, d2gfbm2, d2gfbn2, d2gfbo2, d2gfbp2 |
PDB Entry: 2gfb (more details), 3 Å
SCOP Domain Sequences for d2gfbh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbh1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain} dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak ttap
Timeline for d2gfbh1:
View in 3D Domains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp1, d2gfbp2 |