Lineage for d3nrjk_ (3nrj K:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167647Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2167648Protein automated matches [190447] (51 species)
    not a true protein
  7. 2167958Species Pseudomonas syringae [TaxId:264730] [196431] (2 PDB entries)
  8. 2167969Domain d3nrjk_: 3nrj K: [199971]
    Other proteins in same PDB: d3nrja2, d3nrjc2, d3nrjd2, d3nrje2, d3nrjf2, d3nrjg2, d3nrjh2, d3nrji2
    automated match to d3nrjl_
    complexed with cl, mg, po4, unl

Details for d3nrjk_

PDB Entry: 3nrj (more details), 1.9 Å

PDB Description: crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium
PDB Compounds: (K:) probable yrbi family phosphatase

SCOPe Domain Sequences for d3nrjk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nrjk_ c.108.1.0 (K:) automated matches {Pseudomonas syringae [TaxId: 264730]}
qdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaiis
grktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirrv
glgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyl

SCOPe Domain Coordinates for d3nrjk_:

Click to download the PDB-style file with coordinates for d3nrjk_.
(The format of our PDB-style files is described here.)

Timeline for d3nrjk_: