Lineage for d3nrjg_ (3nrj G:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1629211Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1629212Protein automated matches [190447] (45 species)
    not a true protein
  7. 1629490Species Pseudomonas syringae [TaxId:264730] [196431] (2 PDB entries)
  8. 1629509Domain d3nrjg_: 3nrj G: [199967]
    automated match to d3nrjl_
    complexed with cl, mg, po4, unl

Details for d3nrjg_

PDB Entry: 3nrj (more details), 1.9 Å

PDB Description: crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium
PDB Compounds: (G:) probable yrbi family phosphatase

SCOPe Domain Sequences for d3nrjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nrjg_ c.108.1.0 (G:) automated matches {Pseudomonas syringae [TaxId: 264730]}
qdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaiis
grktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirrv
glgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyle

SCOPe Domain Coordinates for d3nrjg_:

Click to download the PDB-style file with coordinates for d3nrjg_.
(The format of our PDB-style files is described here.)

Timeline for d3nrjg_: