![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Pseudomonas syringae [TaxId:264730] [196431] (2 PDB entries) |
![]() | Domain d3nrjg1: 3nrj G:8-179 [199967] Other proteins in same PDB: d3nrja2, d3nrjc2, d3nrjd2, d3nrje2, d3nrjf2, d3nrjg2, d3nrjh2, d3nrji2 automated match to d3nrjl_ complexed with cl, mg, po4, unl |
PDB Entry: 3nrj (more details), 1.9 Å
SCOPe Domain Sequences for d3nrjg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nrjg1 c.108.1.0 (G:8-179) automated matches {Pseudomonas syringae [TaxId: 264730]} qdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaiis grktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirrv glgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyl
Timeline for d3nrjg1: