Lineage for d3nigl2 (3nig L:108-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2363775Domain d3nigl2: 3nig L:108-214 [199956]
    Other proteins in same PDB: d3niga_, d3nigc_, d3nigf1, d3nigl1
    automated match to d1dqdl2
    complexed with ca, gol, mg, nag, so4

Details for d3nigl2

PDB Entry: 3nig (more details), 2.25 Å

PDB Description: the closed headpiece of integrin iib 3 and its complex with an iib 3 - specific antagonist that does not induce opening
PDB Compounds: (L:) Mmonoclonal antibody 10E5 light chain

SCOPe Domain Sequences for d3nigl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nigl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3nigl2:

Click to download the PDB-style file with coordinates for d3nigl2.
(The format of our PDB-style files is described here.)

Timeline for d3nigl2: