SCOPe 2.05: Domain d3ndoa_: 3ndo A:

Lineage for d3ndoa_ (3ndo A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (63 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:1772] [196434] (1 PDB entry)

8. Domain d3ndoa_: 3ndo A: [199940]
   automated match to d3ndob_
   complexed with gol, nh4, unl

Details for d3ndoa_

PDB Entry: 3ndo, 1.25 Å

PDB Description: crystal structure of deoxyribose phosphate aldolase from mycobacterium smegmatis

PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d3ndoa_:

Sequence; same for both SEQRES and ATOM records:

>d3ndoa_ c.1.10.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
dhtraqvaalvdhtllkpeatpsdvtalvdeaadlgvfavcvspplvsvaagvapsglai
aavagfpsgkhvpgikateaelavaagateidmvidvgaalagdldavsaditavrkavr
aatlkvivesaallefsgeplladvcrvardagadfvktstgfhpsggasvqaveimart
vgerlgvkasggirtaeqaaamldagatrlglsgsravldgfgsa

Timeline for d3ndoa_:

• d3ndoa_ first appeared in SCOPe 2.03
  
• d3ndoa_ appears in SCOPe 2.04
  
• d3ndoa_ appears in SCOPe 2.06
  
• d3ndoa_ appears in the current release, SCOPe 2.08