SCOPe 2.06: Domain d3n8ha1: 3n8h A:1-261

Lineage for d3n8ha1 (3n8h A:1-261)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [196438] (3 PDB entries)

8. Domain d3n8ha1: 3n8h A:1-261 [199939]
   Other proteins in same PDB: d3n8ha2, d3n8hb2
   automated match to d3n8hb_
   complexed with acy, amp, gol, pro

Details for d3n8ha1

PDB Entry: 3n8h, 2 Å

PDB Description: crystal structure of pantoate-beta-alanine ligase from francisella tularensis

PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3n8ha1:

Sequence; same for both SEQRES and ATOM records:

>d3n8ha1 c.26.1.0 (A:1-261) automated matches {Francisella tularensis [TaxId: 177416]}
miiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnptq
fnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegks
rpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqps
glplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrifl
afyigkvrlidnflketgpsc

Timeline for d3n8ha1:

• d3n8ha1 first appeared in SCOPe 2.03, called d3n8ha_
  
• d3n8ha1 was called d3n8ha_ in SCOPe 2.05
  
• d3n8ha1 appears in SCOPe 2.07
  
• d3n8ha1 appears in the current release, SCOPe 2.08