Lineage for d3n74c_ (3n74 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094558Species Brucella melitensis [TaxId:359391] [189369] (3 PDB entries)
  8. 2094561Domain d3n74c_: 3n74 C: [199938]
    automated match to d3n74d_

Details for d3n74c_

PDB Entry: 3n74 (more details), 2.2 Å

PDB Description: Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from Brucella melitensis
PDB Compounds: (C:) 3-ketoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d3n74c_:

Sequence, based on SEQRES records: (download)

>d3n74c_ c.2.1.0 (C:) automated matches {Brucella melitensis [TaxId: 359391]}
mslegkvalitgagsgfgegmakrfakggakvvivdrdkagaervageigdaalavaadi
skeadvdaaveaalskfgkvdilvnnagighkpqnaelvepeefdrivgvnvrgvylmts
kliphfkengakgqecvilnvastgagrprpnlawynatkgwvvsvtkalaielapakir
vvalnpvagetpllttfmgedseeirkkfrdsipmgrllkpddlaeaaaflcspqasmit
gvaldvdggrsi

Sequence, based on observed residues (ATOM records): (download)

>d3n74c_ c.2.1.0 (C:) automated matches {Brucella melitensis [TaxId: 359391]}
mslegkvalitgagsgfgegmakrfakggakvvivdrdkagaervageigdaalavaadi
skeadvdaaveaalskfgkvdilvnnagighkpqnaelvepeefdrivgvnvrgvylmts
kliphfkengakgqecvilnvastgagrprpnlawynatkgwvvsvtkalaielapakir
vvalnpvtfmgedssipmgrllkpddlaeaaaflcspqasmitgvaldvdggrsi

SCOPe Domain Coordinates for d3n74c_:

Click to download the PDB-style file with coordinates for d3n74c_.
(The format of our PDB-style files is described here.)

Timeline for d3n74c_: