SCOPe 2.08: Domain d3n5ma1: 3n5m A:1-449

Lineage for d3n5ma1 (3n5m A:1-449)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196443] (1 PDB entry)

8. Domain d3n5ma1: 3n5m A:1-449 [199933]
   Other proteins in same PDB: d3n5ma2, d3n5mb2, d3n5mc2, d3n5md2
   automated match to d3n5md_
   complexed with cl, so4

Details for d3n5ma1

PDB Entry: 3n5m, 2.05 Å

PDB Description: crystals structure of a bacillus anthracis aminotransferase

PDB Compounds: (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d3n5ma1:

Sequence; same for both SEQRES and ATOM records:

>d3n5ma1 c.67.1.0 (A:1-449) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwcvns
gygrkelaeaaykqlqtlsyfpmsqshepaiklaeklnewlggeyviffsnsgseaneta
fkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvtppd
cyrmpgiereniydvecvkevdrvmtwelsetiaafimepiitgggilmapqdymkavhe
tcqkhgallisdevicgfgrtgkafgfmnydvkpdiitmakgitsaylplsatavkreiy
eafkgkgeyeffrhintfggnpaacalalknleiienenliersaqmgsllleqlkeeig
ehplvgdirgkgllvgielvndketkepidndkiasvvnackekgliigrngmttagynn
iltlapplvisseeiafvigtlktameri

Timeline for d3n5ma1:

• d3n5ma1 first appeared in SCOPe 2.03, called d3n5ma_
  
• d3n5ma1 appears in SCOPe 2.07