Lineage for d3n4ma2 (3n4m A:138-209)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306440Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 2306441Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 2306442Species Escherichia coli [TaxId:562] [46798] (27 PDB entries)
  8. 2306470Domain d3n4ma2: 3n4m A:138-209 [199932]
    Other proteins in same PDB: d3n4ma1, d3n4mb_, d3n4mc_
    automated match to d1i5zb1
    protein/DNA complex; protein/RNA complex; complexed with cmp, peg

Details for d3n4ma2

PDB Entry: 3n4m (more details), 2.99 Å

PDB Description: e. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d3n4ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n4ma2 a.4.5.4 (A:138-209) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygtr

SCOPe Domain Coordinates for d3n4ma2:

Click to download the PDB-style file with coordinates for d3n4ma2.
(The format of our PDB-style files is described here.)

Timeline for d3n4ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n4ma1