Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) |
Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species) N-terminal domain has double beta-helix fold |
Species Escherichia coli [TaxId:562] [46798] (27 PDB entries) |
Domain d3n4ma2: 3n4m A:138-209 [199932] Other proteins in same PDB: d3n4ma1, d3n4mb_, d3n4mc_ automated match to d1i5zb1 protein/DNA complex; protein/RNA complex; complexed with cmp, peg |
PDB Entry: 3n4m (more details), 2.99 Å
SCOPe Domain Sequences for d3n4ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n4ma2 a.4.5.4 (A:138-209) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis ahgktivvygtr
Timeline for d3n4ma2: