SCOPe 2.06: Domain d3n3ka_: 3n3k A:

Lineage for d3n3ka_ (3n3k A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
   Pfam PF00443

6. Protein Ubiquitin carboxyl-terminal hydrolase 8 [142858] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142859] (2 PDB entries)
   Uniprot P40818 762-1109

8. Domain d3n3ka_: 3n3k A: [199930]
   Other proteins in same PDB: d3n3kb_
   automated match to d2gfoa1
   complexed with zn

Details for d3n3ka_

PDB Entry: 3n3k, 2.6 Å

PDB Description: the catalytic domain of usp8 in complex with a usp8 specific inhibitor

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 8

SCOPe Domain Sequences for d3n3ka_:

Sequence; same for both SEQRES and ATOM records:

>d3n3ka_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]}
rlsasqirnlnpvfggsgpaltglrnlgntcymnsilqclcnaphladyfnrncyqddin
rsnllghkgevaeefgiimkalwtgqyryispkdfkitigkindqfagysqqdsqelllf
lmdglhedlnkadnrkrykeenndhlddfkaaehawqkhkqlnesiivalfqgqfkstvq
cltchkksrtfeafmylslplastskctlqdclrlfskeekltdnnrfycshcrarrdsl
kkieiwklppvllvhlkrfsydgrwkqklqtsvdfplenldlsqyvigpknnlkkynlfs
vsnhyggldgghytaycknaarqrwfkfddhevsdisvssvkssaayilfytslg

Timeline for d3n3ka_:

• d3n3ka_ first appeared in SCOPe 2.03
  
• d3n3ka_ appears in SCOPe 2.05
  
• d3n3ka_ appears in SCOPe 2.07
  
• d3n3ka_ appears in the current release, SCOPe 2.08