Lineage for d2gfbb1 (2gfb B:1-119)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2021955Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (59 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2022037Domain d2gfbb1: 2gfb B:1-119 [19993]
    Other proteins in same PDB: d2gfba1, d2gfba2, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp2
    part of Fab CNJ206; H-chains in this entry seem to be mistraced in VH region

Details for d2gfbb1

PDB Entry: 2gfb (more details), 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity
PDB Compounds: (B:) igg2a cnj206 fab (heavy chain)

SCOPe Domain Sequences for d2gfbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfbb1 b.1.1.1 (B:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
ttap

SCOPe Domain Coordinates for d2gfbb1:

Click to download the PDB-style file with coordinates for d2gfbb1.
(The format of our PDB-style files is described here.)

Timeline for d2gfbb1: