Lineage for d3n07c_ (3n07 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920684Species Vibrio cholerae [TaxId:666] [193720] (1 PDB entry)
  8. 2920687Domain d3n07c_: 3n07 C: [199918]
    automated match to d3n07d_
    complexed with mg

Details for d3n07c_

PDB Entry: 3n07 (more details), 1.76 Å

PDB Description: structure of putative 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from vibrio cholerae
PDB Compounds: (C:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d3n07c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n07c_ c.108.1.0 (C:) automated matches {Vibrio cholerae [TaxId: 666]}
sstvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgygvka
lmnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtgyig
ddlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarnel

SCOPe Domain Coordinates for d3n07c_:

Click to download the PDB-style file with coordinates for d3n07c_.
(The format of our PDB-style files is described here.)

Timeline for d3n07c_: