Lineage for d3n07b_ (3n07 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1884234Species Vibrio cholerae [TaxId:666] [193720] (1 PDB entry)
  8. 1884236Domain d3n07b_: 3n07 B: [199917]
    automated match to d3n07d_
    complexed with mg

Details for d3n07b_

PDB Entry: 3n07 (more details), 1.76 Å

PDB Description: structure of putative 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from vibrio cholerae
PDB Compounds: (B:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d3n07b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n07b_ c.108.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
sstvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgygvka
lmnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtgyig
ddlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarnel

SCOPe Domain Coordinates for d3n07b_:

Click to download the PDB-style file with coordinates for d3n07b_.
(The format of our PDB-style files is described here.)

Timeline for d3n07b_: