| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) ![]() |
| Family d.58.10.0: automated matches [191394] (1 protein) not a true family |
| Protein automated matches [190511] (8 species) not a true protein |
| Species Synechocystis sp. PCC 6803 [TaxId:1148] [187803] (2 PDB entries) |
| Domain d3mzie_: 3mzi E: [199915] automated match to d3mzif_ complexed with fmn; mutant |
PDB Entry: 3mzi (more details), 2.3 Å
SCOPe Domain Sequences for d3mzie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mzie_ d.58.10.0 (E:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
slyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvne
tyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlrp
samdpeqclnflldiakiye
Timeline for d3mzie_: