SCOPe 2.05: Domain d3mzib_: 3mzi B:

Lineage for d3mzib_ (3mzi B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families)

5. Family d.58.10.0: automated matches [191394] (1 protein)
   not a true family

6. Protein automated matches [190511] (7 species)
   not a true protein

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [187803] (2 PDB entries)

8. Domain d3mzib_: 3mzi B: [199912]
   automated match to d3mzif_
   complexed with fmn; mutant

Details for d3mzib_

PDB Entry: 3mzi, 2.3 Å

PDB Description: Crystallographic structure of the pseudo-Signaling State of the BLUF Photoreceptor PixD (slr1694) Y8F mutant

PDB Compounds: (B:) Activator of photopigment and puc expression

SCOPe Domain Sequences for d3mzib_:

Sequence; same for both SEQRES and ATOM records:

>d3mzib_ d.58.10.0 (B:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
slyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvne
tyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlrp
samdpeqclnflldiakiye

Timeline for d3mzib_:

• d3mzib_ first appeared in SCOPe 2.03
  
• d3mzib_ appears in SCOPe 2.04
  
• d3mzib_ appears in SCOPe 2.06
  
• d3mzib_ appears in the current release, SCOPe 2.08