Lineage for d1rvfh_ (1rvf H:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652752Domain d1rvfh_: 1rvf H: [19991]
    Other proteins in same PDB: d1rvf.1, d1rvf1_, d1rvf3_, d1rvfl_
    part of Fv 17-Ia

Details for d1rvfh_

PDB Entry: 1rvf (more details), 4 Å

PDB Description: fab complexed with intact human rhinovirus
PDB Compounds: (H:) fab 17-ia

SCOP Domain Sequences for d1rvfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qgqlqqsgaelvrpgssvkisckasgyafssfwvnwvkqrpgqglewigqiypgdgdnky
ngkfkgkatltadkssttaymqlysltsedsavyfcarsgnypyamdywgqgtsvtvss

SCOP Domain Coordinates for d1rvfh_:

Click to download the PDB-style file with coordinates for d1rvfh_.
(The format of our PDB-style files is described here.)

Timeline for d1rvfh_: