SCOP 1.69: Domain d1rvfh_: 1rvf H:

Lineage for d1rvfh_ (1rvf H:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d1rvfh_: 1rvf H: [19991]
   Other proteins in same PDB: d1rvf.1, d1rvf1_, d1rvf3_, d1rvfl_
   part of Fv 17-Ia

Details for d1rvfh_

PDB Entry: 1rvf, 4 Å

PDB Description: fab complexed with intact human rhinovirus

SCOP Domain Sequences for d1rvfh_:

Sequence; same for both SEQRES and ATOM records:

>d1rvfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qgqlqqsgaelvrpgssvkisckasgyafssfwvnwvkqrpgqglewigqiypgdgdnky
ngkfkgkatltadkssttaymqlysltsedsavyfcarsgnypyamdywgqgtsvtvss

Timeline for d1rvfh_:

• d1rvfh_ first appeared (with stable ids) in SCOP 1.55
  
• d1rvfh_ appears in SCOP 1.67
  
• d1rvfh_ appears in SCOP 1.71
  
• d1rvfh_ appears in the current release, SCOPe 2.08