Lineage for d3my5b2 (3my5 B:309-432)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273869Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1273870Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1273871Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1273884Protein Cyclin A [47956] (2 species)
  7. 1273885Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries)
  8. 1273895Domain d3my5b2: 3my5 B:309-432 [199907]
    Other proteins in same PDB: d3my5a_, d3my5c_
    automated match to d1vina2
    complexed with fmt, rfz, sgm

Details for d3my5b2

PDB Entry: 3my5 (more details), 2.1 Å

PDB Description: CDk2/cyclinA in complex with DRB
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3my5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3my5b2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnv

SCOPe Domain Coordinates for d3my5b2:

Click to download the PDB-style file with coordinates for d3my5b2.
(The format of our PDB-style files is described here.)

Timeline for d3my5b2: