SCOPe 2.04: Domain d3my1b2: 3my1 B:151-259

Lineage for d3my1b2 (3my1 B:151-259)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin T1 [158595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
   Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150

8. Domain d3my1b2: 3my1 B:151-259 [199905]
   Other proteins in same PDB: d3my1a_
   automated match to d3blhb1
   complexed with gol, po4, rfz

Details for d3my1b2

PDB Entry: 3my1, 2.8 Å

PDB Description: Structure of CDK9/cyclinT1 in complex with DRB

PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d3my1b2:

Sequence; same for both SEQRES and ATOM records:

>d3my1b2 a.74.1.1 (B:151-259) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr

Timeline for d3my1b2:

• d3my1b2 first appeared in SCOPe 2.03
  
• d3my1b2 appears in SCOPe 2.05
  
• d3my1b2 appears in the current release, SCOPe 2.08