SCOPe 2.04: Domain d3mwma_: 3mwm A:

Lineage for d3mwma_ (3mwm A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [196367] (2 PDB entries)

8. Domain d3mwma_: 3mwm A: [199901]
   automated match to d3mwmb_
   complexed with zn

Details for d3mwma_

PDB Entry: 3mwm, 2.4 Å

PDB Description: graded expression of zinc-responsive genes through two regulatory zinc-binding sites in zur

PDB Compounds: (A:) Putative metal uptake regulation protein

SCOPe Domain Sequences for d3mwma_:

Sequence; same for both SEQRES and ATOM records:

>d3mwma_ a.4.5.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
gratrqraavsaalqeveefrsaqelhdmlkhkgdavglttvyrtlqsladagevdvlrt
aegesvyrrcstgdhhhhlvcracgkavevegpavekwaeaiaaehgyvnvahtveifgt
cadcaga

Timeline for d3mwma_:

• d3mwma_ first appeared in SCOPe 2.03
  
• d3mwma_ appears in SCOPe 2.05
  
• d3mwma_ appears in the current release, SCOPe 2.08