Class a: All alpha proteins [46456] (286 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (6 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (34 PDB entries) |
Domain d3mvdc_: 3mvd C: [199898] Other proteins in same PDB: d3mvda_, d3mvdb_, d3mvdd_, d3mvde_, d3mvdf_, d3mvdh_ automated match to d1eqza_ protein/DNA complex |
PDB Entry: 3mvd (more details), 2.9 Å
SCOPe Domain Sequences for d3mvdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mvdc_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]} akaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaar dnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
Timeline for d3mvdc_: