Lineage for d3mt6w_ (3mt6 W:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1835241Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 1835406Protein automated matches [190149] (9 species)
    not a true protein
  7. 1835465Species Escherichia coli K-12 [TaxId:83333] [196414] (1 PDB entry)
  8. 1835488Domain d3mt6w_: 3mt6 W: [199894]
    automated match to d3mt6g_
    complexed with mpd

Details for d3mt6w_

PDB Entry: 3mt6 (more details), 1.9 Å

PDB Description: structure of clpp from escherichia coli in complex with adep1
PDB Compounds: (W:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3mt6w_:

Sequence, based on SEQRES records: (download)

>d3mt6w_ c.14.1.1 (W:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl
yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi
hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave
yglvdsilthr

Sequence, based on observed residues (ATOM records): (download)

>d3mt6w_ c.14.1.1 (W:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvpmvisfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggv
itagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyq
gqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsil
thr

SCOPe Domain Coordinates for d3mt6w_:

Click to download the PDB-style file with coordinates for d3mt6w_.
(The format of our PDB-style files is described here.)

Timeline for d3mt6w_: