Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (7 species) not a true protein |
Species Escherichia coli [TaxId:83333] [196414] (1 PDB entry) |
Domain d3mt6c_: 3mt6 C: [199875] automated match to d3mt6g_ complexed with mpd |
PDB Entry: 3mt6 (more details), 1.9 Å
SCOPe Domain Sequences for d3mt6c_:
Sequence, based on SEQRES records: (download)
>d3mt6c_ c.14.1.1 (C:) automated matches {Escherichia coli [TaxId: 83333]} lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave yglvdsilth
>d3mt6c_ c.14.1.1 (C:) automated matches {Escherichia coli [TaxId: 83333]} lvpmvieqtgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyi nspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihq plggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyg lvdsilth
Timeline for d3mt6c_: