SCOPe 2.07: Domain d3mqka2: 3mqk A:252-338

Lineage for d3mqka2 (3mqk A:252-338)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (7 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [225693] (3 PDB entries)

8. Domain d3mqka2: 3mqk A:252-338 [199870]
   Other proteins in same PDB: d3mqka1, d3mqkb_, d3mqkc_
   automated match to d2apoa1
   protein/RNA complex

Details for d3mqka2

PDB Entry: 3mqk, 2.8 Å

PDB Description: Cbf5-Nop10-Gar1 complex binding with 17mer RNA containing ACA trinucleotide

PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d3mqka2:

Sequence; same for both SEQRES and ATOM records:

>d3mqka2 b.122.1.0 (A:252-338) automated matches {Pyrococcus furiosus [TaxId: 2261]}
hlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqe
mlektkgiavdvekvfmprdwypklwe

Timeline for d3mqka2:

• d3mqka2 first appeared in SCOPe 2.03
  
• d3mqka2 appears in SCOPe 2.06
  
• d3mqka2 appears in the current release, SCOPe 2.08