Lineage for d1nccl1 (1ncc L:1-108)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158321Species Fab NC41 (mouse), kappa L chain [48790] (4 PDB entries)
  8. 158327Domain d1nccl1: 1ncc L:1-108 [19986]
    Other proteins in same PDB: d1ncch2, d1nccl2, d1nccn_

Details for d1nccl1

PDB Entry: 1ncc (more details), 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

SCOP Domain Sequences for d1nccl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nccl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab NC41 (mouse), kappa L chain}
divmtqspkfmstsvgdrvtitckasqdvstavvwyqqkpgqspklliywastrhigvpd
rfagsgsgtdytltissvqaedlalyycqqhysppwtfgggtkleikr

SCOP Domain Coordinates for d1nccl1:

Click to download the PDB-style file with coordinates for d1nccl1.
(The format of our PDB-style files is described here.)

Timeline for d1nccl1: