SCOP 1.71: Domain d1ncdh1: 1ncd H:1-113

Lineage for d1ncdh1 (1ncd H:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)

8. Domain d1ncdh1: 1ncd H:1-113 [19985]
   Other proteins in same PDB: d1ncdh2, d1ncdl1, d1ncdl2, d1ncdn_
   part of Fab NC41
   complexed with ca, man, nag

Details for d1ncdh1

PDB Entry: 1ncd, 2.9 Å

PDB Description: refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex

SCOP Domain Sequences for d1ncdh1:

Sequence; same for both SEQRES and ATOM records:

>d1ncdh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglewmgwintntgepty
geefkgrfafsletsastanlqinnlknedkatffcargednfgslsdywgqgttltvss

Timeline for d1ncdh1:

• d1ncdh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ncdh1 appears in SCOP 1.69
  
• d1ncdh1 appears in SCOP 1.73
  
• d1ncdh1 appears in the current release, SCOPe 2.08