Lineage for d3mgfa_ (3mgf A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407957Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1407958Protein automated matches [190526] (17 species)
    not a true protein
  7. 1408174Species Verrillofungia concinna [TaxId:496660] [196369] (1 PDB entry)
  8. 1408175Domain d3mgfa_: 3mgf A: [199849]
    automated match to d3mgfd_

Details for d3mgfa_

PDB Entry: 3mgf (more details), 1.8 Å

PDB Description: Crystal Structure of Monomeric Kusabira-Orange (MKO), Orange-Emitting GFP-like Protein, at pH 7.5
PDB Compounds: (A:) fluorescent protein

SCOPe Domain Sequences for d3mgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgfa_ d.22.1.0 (A:) automated matches {Verrillofungia concinna [TaxId: 496660]}
svikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvsh
vfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhksk
ftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyka
akkilkmpgshyishrlvrktegnitelvedavahs

SCOPe Domain Coordinates for d3mgfa_:

Click to download the PDB-style file with coordinates for d3mgfa_.
(The format of our PDB-style files is described here.)

Timeline for d3mgfa_: