Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (3 PDB entries) |
Domain d3mg6r_: 3mg6 R: [199840] Other proteins in same PDB: d3mg61_, d3mg62_, d3mg6a_, d3mg6b_, d3mg6c_, d3mg6e_, d3mg6f_, d3mg6g_, d3mg6h_, d3mg6i_, d3mg6j_, d3mg6k_, d3mg6l_, d3mg6m_, d3mg6n_, d3mg6o_, d3mg6p_, d3mg6q_, d3mg6s_, d3mg6t_, d3mg6u_, d3mg6v_, d3mg6w_, d3mg6x_, d3mg6y_, d3mg6z_ automated match to d4eu2f_ complexed with lzt, mes, mg |
PDB Entry: 3mg6 (more details), 2.6 Å
SCOPe Domain Sequences for d3mg6r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mg6r_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea ae
Timeline for d3mg6r_:
View in 3D Domains from other chains: (mouse over for more information) d3mg61_, d3mg62_, d3mg6a_, d3mg6b_, d3mg6c_, d3mg6d_, d3mg6e_, d3mg6f_, d3mg6g_, d3mg6h_, d3mg6i_, d3mg6j_, d3mg6k_, d3mg6l_, d3mg6m_, d3mg6n_, d3mg6o_, d3mg6p_, d3mg6q_, d3mg6s_, d3mg6t_, d3mg6u_, d3mg6v_, d3mg6w_, d3mg6x_, d3mg6y_, d3mg6z_ |