Lineage for d3mega2 (3meg A:430-552)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887284Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)
  8. 2887305Domain d3mega2: 3meg A:430-552 [199836]
    Other proteins in same PDB: d3mega1, d3megb_
    automated match to d1bqna1
    complexed with so4, t27

Details for d3mega2

PDB Entry: 3meg (more details), 2.8 Å

PDB Description: hiv-1 k103n reverse transcriptase in complex with tmc278
PDB Compounds: (A:) p66 Reverse transcriptase

SCOPe Domain Sequences for d3mega2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mega2 c.55.3.0 (A:430-552) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

SCOPe Domain Coordinates for d3mega2:

Click to download the PDB-style file with coordinates for d3mega2.
(The format of our PDB-style files is described here.)

Timeline for d3mega2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mega1
View in 3D
Domains from other chains:
(mouse over for more information)
d3megb_