SCOPe 2.08: Domain d3meda2: 3med A:430-552

Lineage for d3meda2 (3med A:430-552)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)

8. Domain d3meda2: 3med A:430-552 [199832]
   Other proteins in same PDB: d3meda1, d3medb_
   automated match to d1bqna1
   complexed with 65b, cl, so4

Details for d3meda2

PDB Entry: 3med, 2.5 Å

PDB Description: hiv-1 k103n reverse transcriptase in complex with tmc125

PDB Compounds: (A:) p66 Reverse transcriptase

SCOPe Domain Sequences for d3meda2:

Sequence; same for both SEQRES and ATOM records:

>d3meda2 c.55.3.0 (A:430-552) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d3meda2:

• d3meda2 first appeared in SCOPe 2.03
  
• d3meda2 appears in SCOPe 2.07