SCOP 1.73: Domain d1ncah1: 1nca H:1-113

Lineage for d1ncah1 (1nca H:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)

8. Domain d1ncah1: 1nca H:1-113 [19983]
   Other proteins in same PDB: d1ncah2, d1ncal1, d1ncal2, d1ncan_
   part of Fab NC41
   complexed with ca, man, nag

Details for d1ncah1

PDB Entry: 1nca, 2.5 Å

PDB Description: refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex

PDB Compounds: (H:) igg2a-kappa nc41 fab (heavy chain)

SCOP Domain Sequences for d1ncah1:

Sequence; same for both SEQRES and ATOM records:

>d1ncah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintntgepty
geefkgrfafsletsastanlqinnlknedtatffcargednfgslsdywgqgttvtvss

Timeline for d1ncah1:

• d1ncah1 first appeared (with stable ids) in SCOP 1.55
  
• d1ncah1 appears in SCOP 1.71
  
• d1ncah1 appears in SCOP 1.75
  
• d1ncah1 appears in the current release, SCOPe 2.08