Lineage for d3mc0d1 (3mc0 D:2-115)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1541040Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 1541041Protein automated matches [226834] (4 species)
    not a true protein
  7. 1541042Species Staphylococcus aureus [TaxId:1280] [225054] (6 PDB entries)
  8. 1541047Domain d3mc0d1: 3mc0 D:2-115 [199825]
    Other proteins in same PDB: d3mc0a_, d3mc0b2, d3mc0c_, d3mc0d2
    automated match to d1d5zc1
    complexed with act

Details for d3mc0d1

PDB Entry: 3mc0 (more details), 2 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a Mouse T-cell Receptor beta Chain
PDB Compounds: (D:) Enterotoxin SEG

SCOPe Domain Sequences for d3mc0d1:

Sequence, based on SEQRES records: (download)

>d3mc0d1 b.40.2.0 (D:2-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
pdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyne
vktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltf

Sequence, based on observed residues (ATOM records): (download)

>d3mc0d1 b.40.2.0 (D:2-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
pdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyne
vktelentelannykgkkvdifgvpyfytciipksenfggccmyggltf

SCOPe Domain Coordinates for d3mc0d1:

Click to download the PDB-style file with coordinates for d3mc0d1.
(The format of our PDB-style files is described here.)

Timeline for d3mc0d1: