![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
![]() | Protein automated matches [226834] (5 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [225054] (10 PDB entries) |
![]() | Domain d3mc0d1: 3mc0 D:2-115 [199825] Other proteins in same PDB: d3mc0a_, d3mc0b2, d3mc0c_, d3mc0d2 automated match to d1d5zc1 complexed with act |
PDB Entry: 3mc0 (more details), 2 Å
SCOPe Domain Sequences for d3mc0d1:
Sequence, based on SEQRES records: (download)
>d3mc0d1 b.40.2.0 (D:2-115) automated matches {Staphylococcus aureus [TaxId: 1280]} pdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyne vktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltf
>d3mc0d1 b.40.2.0 (D:2-115) automated matches {Staphylococcus aureus [TaxId: 1280]} pdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyne vktelentelannykgkkvdifgvpyfytciipksenfggccmyggltf
Timeline for d3mc0d1:
![]() Domains from other chains: (mouse over for more information) d3mc0a_, d3mc0b1, d3mc0b2, d3mc0c_ |