Lineage for d3mc0b1 (3mc0 B:1-115)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314466Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 1314467Protein automated matches [226834] (4 species)
    not a true protein
  7. 1314468Species Staphylococcus aureus [TaxId:1280] [225054] (6 PDB entries)
  8. 1314472Domain d3mc0b1: 3mc0 B:1-115 [199823]
    Other proteins in same PDB: d3mc0a_, d3mc0b2, d3mc0c_, d3mc0d2
    automated match to d1d5zc1
    complexed with act

Details for d3mc0b1

PDB Entry: 3mc0 (more details), 2 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a Mouse T-cell Receptor beta Chain
PDB Compounds: (B:) Enterotoxin SEG

SCOPe Domain Sequences for d3mc0b1:

Sequence, based on SEQRES records: (download)

>d3mc0b1 b.40.2.0 (B:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
evktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltf

Sequence, based on observed residues (ATOM records): (download)

>d3mc0b1 b.40.2.0 (B:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
evktelentelannykgkkvdifgvpyfytciipksenfggccmyggltf

SCOPe Domain Coordinates for d3mc0b1:

Click to download the PDB-style file with coordinates for d3mc0b1.
(The format of our PDB-style files is described here.)

Timeline for d3mc0b1: