Lineage for d1ncal1 (1nca L:1-108)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288075Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
  8. 288177Domain d1ncal1: 1nca L:1-108 [19982]
    Other proteins in same PDB: d1ncah1, d1ncah2, d1ncal2, d1ncan_
    part of Fab NC41
    complexed with ca, man, nag

Details for d1ncal1

PDB Entry: 1nca (more details), 2.5 Å

PDB Description: refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex

SCOP Domain Sequences for d1ncal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncal1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divmtqspkfmstsvgdrvtitckasqdvstavvwyqqkpgqspklliywastrhigvpd
rfagsgsgtdytltissvqaedlalyycqqhysppwtfgggtkleikr

SCOP Domain Coordinates for d1ncal1:

Click to download the PDB-style file with coordinates for d1ncal1.
(The format of our PDB-style files is described here.)

Timeline for d1ncal1: