Lineage for d1ncal1 (1nca L:1-108)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219893Species Fab NC41 (mouse), kappa L chain [48790] (4 PDB entries)
  8. 219897Domain d1ncal1: 1nca L:1-108 [19982]
    Other proteins in same PDB: d1ncah2, d1ncal2, d1ncan_

Details for d1ncal1

PDB Entry: 1nca (more details), 2.5 Å

PDB Description: refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex

SCOP Domain Sequences for d1ncal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncal1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab NC41 (mouse), kappa L chain}
divmtqspkfmstsvgdrvtitckasqdvstavvwyqqkpgqspklliywastrhigvpd
rfagsgsgtdytltissvqaedlalyycqqhysppwtfgggtkleikr

SCOP Domain Coordinates for d1ncal1:

Click to download the PDB-style file with coordinates for d1ncal1.
(The format of our PDB-style files is described here.)

Timeline for d1ncal1: