SCOPe 2.07: Domain d3ma7a1: 3ma7 A:7-185

Lineage for d3ma7a1 (3ma7 A:7-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d3ma7a1: 3ma7 A:7-185 [199819]
   Other proteins in same PDB: d3ma7a2, d3ma7b_, d3ma7c2, d3ma7d_
   automated match to d1onqa2
   complexed with cd4, nag, plm

Details for d3ma7a1

PDB Entry: 3ma7, 2.29 Å

PDB Description: crystal structure of cardiolipin bound to mouse cd1d

PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3ma7a1:

Sequence; same for both SEQRES and ATOM records:

>d3ma7a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d3ma7a1:

• d3ma7a1 first appeared in SCOPe 2.03
  
• d3ma7a1 appears in SCOPe 2.06
  
• d3ma7a1 appears in the current release, SCOPe 2.08