SCOPe 2.08: Domain d3m32e1: 3m32 E:2-188

Lineage for d3m32e1 (3m32 E:2-188)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Beta chain [55099] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries)

8. Domain d3m32e1: 3m32 E:2-188 [199815]
   Other proteins in same PDB: d3m32a1, d3m32a2, d3m32b2, d3m32c_, d3m32d1, d3m32d2, d3m32e2, d3m32f_
   automated match to d1hbnb2
   complexed with act, com, edo, f43, mg, peg, sht, tp7, zn

Details for d3m32e1

PDB Entry: 3m32, 1.35 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues

PDB Compounds: (E:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d3m32e1:

Sequence; same for both SEQRES and ATOM records:

>d3m32e1 d.58.31.2 (E:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

Timeline for d3m32e1:

• d3m32e1 first appeared in SCOPe 2.03
  
• d3m32e1 appears in SCOPe 2.07